| Edit |   |
| Antigenic Specificity | C16orf58 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C16orf58 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C16orf58. This antibody reacts with human. The C16orf58 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
| Immunogen | Synthetic peptides corresponding to C16ORF58 The peptide sequence was selected from the N terminal of C16ORF58. Peptide sequence QAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLLGIGVGN. |
| Other Names | chromosome 16 open reading frame 58, FLJ13868, hypothetical protein LOC64755 |
| Gene, Accession # | C16ORF58, Gene ID: 64755, Accession: Q96GQ5, SwissProt: Q96GQ5 |
| Catalog # | NBP1-59541 |
| Price | |
| Order / More Info | C16orf58 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |