| Edit |   |
|---|
| Antigenic Specificity | KRR1, Small Subunit (SSU) Processome Component, Homolog (Yeast) (KRR1) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | KRR1 belongs to the KRR1 family. It contains 1 KH domain. KRR1 is required for 40S ribosome biogenesis. It is involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly. |
|---|
| Immunogen | KRR1 antibody was raised using the C terminal of KRR1 corresponding to a region with amino acids KANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTET |
|---|
| Other Names | hrb2|zgc:136398|HRB2|RIP-1|2610511F02Rik|AI255219|AI428520|D10Ertd773e|Hrb2 |
|---|
| Gene, Accession # | Gene ID: 11103 |
|---|
| Catalog # | ABIN633275 |
|---|
| Price | |
|---|
| Order / More Info | KRR1, Small Subunit (SSU) Processome Component, Homolog (Yeast) (KRR1) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|