| Edit |   |
|---|
| Antigenic Specificity | C16orf71 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C16orf71 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C16orf71. This antibody reacts with human. The C16orf71 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C16ORF71 The peptide sequence was selected from the middle region of C16ORF71. Peptide sequence KASACARKVPADTPQDTKEADSGSRCASRKQGSQAGPGPQLAQGMRLNAE. |
|---|
| Other Names | chromosome 16 open reading frame 71 |
|---|
| Gene, Accession # | C16ORF71, Gene ID: 146562 |
|---|
| Catalog # | NBP1-70439-20ul |
|---|
| Price | |
|---|
| Order / More Info | C16orf71 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|