| Edit |   |
|---|
| Antigenic Specificity | ABCB6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 95%, rat 95%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human ABCB6 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: YYRMIQTNFIDMENMFDLLKEETEVKDLPGAGPLRFQKGRIEFENVHFSYADGRETLQD |
|---|
| Other Names | ATP-binding cassette, sub-family B (MDR/TAP), member 6 (Langereis blood group), EST45597, MTABC3, umat |
|---|
| Gene, Accession # | Gene ID: 10058, UniProt: Q9NP58, ENSG00000115657 |
|---|
| Catalog # | HPA058011 |
|---|
| Price | |
|---|
| Order / More Info | ABCB6 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|