| 产品详情 |
| Edit |   |
| Antigenic Specificity | Rhot1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 25ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB reactivity reported in (PMID:24671417). ICC/IF reactivity reported in (PMID: 26259702). |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Rhot1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Rhot1. This antibody reacts with human, rat. The Rhot1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE |
| Other Names | ARHT1, EC 3.6.5, EC 3.6.5.-, FLJ11040, FLJ12633, hMiro-1, MIRO-1mitochondrial Rho GTPase 1, mitochondrial Rho 1, rac-GTP binding protein-like protein, Rac-GTP-binding protein-like protein, Ras homolog gene family member T1, ras homolog gene family, member T1 |
| Gene, Accession # | RHOT1, Gene ID: 55288 |
| Catalog # | NBP1-89011-25ul |
| Price | |
| Order / More Info | Rhot1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 22131369, 23435261, 24671417, 24896179, 26259702, 26631479 |
| 产品资料 |
|
|