| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Rhot1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Rhot1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Rhot1. This antibody reacts with human, mouse, rat. The Rhot1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to RHOT1(ras homolog gene family, member T1) The peptide sequence was selected from the N terminal of RHOT1 (NP_060777). Peptide sequence MKKDVRILLVGEPRVGKTSLIMSLVSEEFPEEVPPRAEEITIPADVTPER. |
|---|
| Other Names | ARHT1, EC 3.6.5, EC 3.6.5.-, FLJ11040, FLJ12633, hMiro-1, MIRO-1mitochondrial Rho GTPase 1, mitochondrial Rho 1, rac-GTP binding protein-like protein, Rac-GTP-binding protein-like protein, Ras homolog gene family member T1, ras homolog gene family, member T1 |
|---|
| Gene, Accession # | RHOT1, Gene ID: 55288, Accession: Q8IXI2, SwissProt: Q8IXI2 |
|---|
| Catalog # | NBP1-59021 |
|---|
| Price | |
|---|
| Order / More Info | Rhot1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 15146197, 25666615, 26558789 |
|---|
| 产品资料 |
|
|