| Edit |   |
|---|
| Antigenic Specificity | ER Lipid Raft Associated 1 (ERLIN1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Erlin-1 belongs to the band 7/mec-2 family. Erlin-1 and erlin-2 are novel members of the prohibitin family of proteins that define lipid-raft-like domains of the ER. |
|---|
| Immunogen | ERLIN1 antibody was raised using the N terminal of ERLIN1 corresponding to a region with amino acids KNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIH |
|---|
| Other Names | Erlin-1|SPFH1|wu:fa10h05|wu:fb19h05|zgc:110547|erlin-1|C10orf69|KE04|KEO4|2810439N09Rik|C80197|Keo4|Spfh1|RGD1307058|Erlin-2-B|erlin1|spfh1|spfh2|spfh2-B |
|---|
| Gene, Accession # | Gene ID: 10613,226144,293939 |
|---|
| Catalog # | ABIN635966 |
|---|
| Price | |
|---|
| Order / More Info | ER Lipid Raft Associated 1 (ERLIN1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|