| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SAT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SAT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SAT2. This antibody reacts with human. The SAT2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SAT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLV |
|---|
| Other Names | diamine N-acetyltransferase 2, EC 2.3.1.57, Polyamine N-acetyltransferase 2, S, Spermidine/spermine N(1)-acetyltransferase 2, spermidine/spermine N1-acetyltransferase 2, spermidine/spermine N1-acetyltransferase family member 2, SSAT2diamine acetyltransferase 2, Thialysine N-epsilon-acetyltransferase |
|---|
| Gene, Accession # | SAT2, Gene ID: 112483 |
|---|
| Catalog # | NBP2-49244 |
|---|
| Price | |
|---|
| Order / More Info | SAT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|