| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RAG1AP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RAG1AP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAG1AP1. This antibody reacts with human. The RAG1AP1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RAG1AP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDG |
|---|
| Other Names | HsSWEET1RAG1-activating protein 1, probable sugar transporter RAG1AP1, RAG1AP1SWEET1, recombination activating gene 1 activating protein 1, RZPDo834D038D, SCPRP11-540D14.5, slv, solute carrier family 50 (sugar transporter), member 1, Solute carrier family 50 member 1, Stromal cell protein |
|---|
| Gene, Accession # | SLC50A1, Gene ID: 55974 |
|---|
| Catalog # | NBP1-92311 |
|---|
| Price | |
|---|
| Order / More Info | RAG1AP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|