| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CACYBP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 25324676). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CACYBP Antibody from Novus Biologicals is a rabbit polyclonal antibody to CACYBP. This antibody reacts with human, mouse, rat. The CACYBP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat CACYBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITT |
|---|
| Other Names | CacyBP, calcyclin binding protein, GIG5, hCacyBP, MGC87971, RP1-102G20.6, S100A6-binding protein, S100A6BPgrowth-inhibiting gene 5 protein, Siah-interacting protein, Siah-interacting protein (SIP), SIPcalcyclin-binding protein |
|---|
| Gene, Accession # | CACYBP, Gene ID: 27101, Accession: Q9HB71, SwissProt: Q9HB71 |
|---|
| Catalog # | NBP1-87104 |
|---|
| Price | |
|---|
| Order / More Info | CACYBP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25324676 |
|---|
| 产品资料 |
|
|