| Edit |   |
|---|
| Antigenic Specificity | N-Methylpurine-DNA Glycosylase (MPG) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions. |
|---|
| Immunogen | MPG antibody was raised using the middle region of MPG corresponding to a region with amino acids QRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGS |
|---|
| Other Names | BA3871|zgc:162984|si:xx-187g17.9|MPG|MPGR|AAG|ADPG|APNG|CRA36.1|MDG|Mid1|PIG11|PIG16|anpg|9830006D05|AI326268|Aag |
|---|
| Gene, Accession # | Gene ID: 4350 |
|---|
| Catalog # | ABIN635545 |
|---|
| Price | |
|---|
| Order / More Info | N-Methylpurine-DNA Glycosylase (MPG) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|