| Edit |   |
| Antigenic Specificity | FAM96A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 94%, rat 92%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human FAM96A polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSL |
| Other Names | family with sequence similarity 96, member A, FLJ22875 |
| Gene, Accession # | Gene ID: 84191, UniProt: Q9H5X1, ENSG00000166797 |
| Catalog # | HPA040459 |
| Price | |
| Order / More Info | FAM96A Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |