| Edit |   |
|---|
| Antigenic Specificity | Sialidase 1 (Lysosomal Sialidase) (NEU1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | NEU1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A. Mutations in NEU1 gene can lead to sialidosis. |
|---|
| Immunogen | NEU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG |
|---|
| Other Names | MGC81958|AA407268|AA407316|Aglp|Apl|Bat-7|Bat7|G9|Map-2|Neu|Neu-1|NANH|NEU|SIAL1 |
|---|
| Gene, Accession # | Gene ID: 4758,18010,24591 |
|---|
| Catalog # | ABIN630439 |
|---|
| Price | |
|---|
| Order / More Info | Sialidase 1 (Lysosomal Sialidase) (NEU1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|