| Edit |   |
|---|
| Antigenic Specificity | Sialic Acid Binding Ig-Like Lectin 6 (SIGLEC6) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SIGLEC6 is a Putative adhesion molecule that mediates sialic-acid dependent binding to cells. It binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. |
|---|
| Immunogen | SIGLEC6 antibody was raised using the N terminal of SIGLEC6 corresponding to a region with amino acids VPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRL |
|---|
| Other Names | SIGLEC6|CD327|CD33L|CD33L1|CD33L2|CDW327|OBBP1 |
|---|
| Gene, Accession # | Gene ID: 946 |
|---|
| Catalog # | ABIN634746 |
|---|
| Price | |
|---|
| Order / More Info | Sialic Acid Binding Ig-Like Lectin 6 (SIGLEC6) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|