| Edit |   |
|---|
| Antigenic Specificity | Fermitin Family Member 1 (FERMT1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | FERMT1 is involved in cell adhesion, possibly via its interaction with integrins. It may mediate TGF-beta 1 signaling in tumor progression. Defects in FERMT1 are the cause of Kindler syndrome. |
|---|
| Immunogen | FERMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN |
|---|
| Other Names | zgc:123193|C20orf42|5830467P10Rik|Kindlin-1|DTGCU2|KIND1|UNC112A|URP1|RGD1306816|si:ch73-22c10.1|wu:fc32b07 |
|---|
| Gene, Accession # | Gene ID: 55612 |
|---|
| Catalog # | ABIN631240 |
|---|
| Price | |
|---|
| Order / More Info | Fermitin Family Member 1 (FERMT1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|