Edit |   |
Antigenic Specificity | AADACL4 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 20ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The AADACL4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AADACL4. This antibody reacts with human. The AADACL4 Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptide directed towards the middle region of human AADACL4. Peptide sequence IRAQVLIYPVVQAFCLQLPSFQQNQNVPLLSRKFMVTSLCNYLAIDLSWR. |
Other Names | arylacetamide deacetylase-like 4 |
Gene, Accession # | AADACL4, Gene ID: 343066, Accession: NP_001013652, SwissProt: NP_001013652 |
Catalog # | NBP1-91584-20ul |
Price | |
Order / More Info | AADACL4 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |