| Edit |   |
|---|
| Antigenic Specificity | AADACL4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AADACL4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AADACL4. This antibody reacts with human. The AADACL4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human AADACL4. Peptide sequence FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG. |
|---|
| Other Names | arylacetamide deacetylase-like 4 |
|---|
| Gene, Accession # | AADACL4, Gene ID: 343066, Accession: NP_001013652, SwissProt: NP_001013652 |
|---|
| Catalog # | NBP1-91583 |
|---|
| Price | |
|---|
| Order / More Info | AADACL4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|