| Edit |   |
| Antigenic Specificity | AADACL1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AADACL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AADACL1. This antibody reacts with mouse. The AADACL1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human Aadacl1The immunogen for this antibody is Aadacl1. Peptide sequence LQALDFNTPSYQQSMNTPILPRHVMVRYWLDYFKGNYDFVEAMIVNNHTS. |
| Other Names | AADACL1, EC 3.1.1.79, KIAA1363EC 3.1.1, NCEHArylacetamide deacetylase-like 1EC 3.1.1.-, neutral cholesterol ester hydrolase 1 |
| Gene, Accession # | NCEH1, Gene ID: 57552, Accession: NP_848887 |
| Catalog # | NBP1-79318-20ul |
| Price | |
| Order / More Info | AADACL1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |