| Edit |   |
| Antigenic Specificity | FAM167B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 84%, rat 84%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | ICC-IF |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human FAM167B polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PSYLEWTAQVQSQAWRRAQAKPGPGGPGDICGFDSMDSALEWLRRELREM |
| Other Names | family with sequence similarity 167, member B, C1orf90, MGC10820 |
| Gene, Accession # | Gene ID: 84734, UniProt: Q9BTA0, ENSG00000183615 |
| Catalog # | HPA062074 |
| Price | |
| Order / More Info | FAM167B Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |