| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MGAT4B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MGAT4B Antibody from Novus Biologicals is a rabbit polyclonal antibody to MGAT4B. This antibody reacts with human. The MGAT4B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MGAT4B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VVDVYQREFLALRDRLHAAEQESLKRSKELNLVLDEIKRAVSERQALRDG DGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLPHLL |
|---|
| Other Names | alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B, alpha-1,3-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, aminyltransferase, EC 2.4.1.145, GlcNAc-T IVb, GNT-IV, GNT-IVB, isoenzyme B, isozyme B, mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, N-acetylglucosaminyltransferase IVb, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb, UDP-N-acetylglucosamine: alpha-1,3-D-mannosidebeta-1,4-N-acetylglucosaminyltransferase IV, UDP-N-acetylglucosamine: alpha-1,3-D-mannosidebeta-1,4-N-acetylglucosaminyltransferase IVb |
|---|
| Gene, Accession # | MGAT4B, Gene ID: 11282 |
|---|
| Catalog # | NBP2-14236 |
|---|
| Price | |
|---|
| Order / More Info | MGAT4B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|