| 产品详情 |
| Edit |   |
| Antigenic Specificity | ETFB |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ETFB Antibody from Novus Biologicals is a rabbit polyclonal antibody to ETFB. This antibody reacts with human. The ETFB Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ETFB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GLALRPPPSCLFPPDPTPSPPAGQIRVKPDRTGVVTDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQ |
| Other Names | beta-ETF, electron transfer flavoprotein beta subunit, electron transfer flavoprotein beta-subunit, electron transfer flavoprotein subunit beta, electron transfer flavoprotein, beta polypeptide, electron-transfer-flavoprotein, beta polypeptide, electron-transferring-flavoprotein, beta polypeptide, MADD |
| Gene, Accession # | ETFB, Gene ID: 2109 |
| Catalog # | NBP1-89455 |
| Price | |
| Order / More Info | ETFB Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|