| Edit |   |
|---|
| Antigenic Specificity | ISG20L2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ISG20L2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ISG20L2. This antibody reacts with human. The ISG20L2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ISG20L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVD |
|---|
| Other Names | EC 3.1, FLJ12671, interferon stimulated exonuclease gene 20kDa-like 2, interferon-stimulated 20 kDa exonuclease-like 2 |
|---|
| Gene, Accession # | ISG20L2, Gene ID: 81875 |
|---|
| Catalog # | NBP1-82287 |
|---|
| Price | |
|---|
| Order / More Info | ISG20L2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|