| Edit |   |
| Antigenic Specificity | Complement C4a |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Complement C4a Antibody from Novus Biologicals is a rabbit polyclonal antibody to Complement C4a. This antibody reacts with human. The Complement C4a Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Complement C4a antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEI |
| Other Names | C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2, C4, complement component 4A (Rodgers blood group), RG |
| Gene, Accession # | C4A, Gene ID: 720, Accession: P0C0L5 |
| Catalog # | NBP2-46723 |
| Price | |
| Order / More Info | Complement C4a Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |