| Edit |   |
| Antigenic Specificity | AAMP |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AAMP Antibody from Novus Biologicals is a rabbit polyclonal antibody to AAMP. This antibody reacts with human. The AAMP Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is AAMP - middle region. Peptide sequence LKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGD. |
| Other Names | angio-associated migratory cell protein, angio-associated, migratory cell protein |
| Gene, Accession # | AAMP, Gene ID: 14, Accession: Q13685, SwissProt: Q13685 |
| Catalog # | NBP1-98514 |
| Price | |
| Order / More Info | AAMP Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |