| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ERG |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ERG Antibody from Novus Biologicals is a rabbit polyclonal antibody to ERG. This antibody reacts with human. The ERG Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ERG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HYLRETPLPHLTSDDVDKALQNSPRLMHARNTDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQ |
|---|
| Other Names | transcriptional regulator ERG, 10ets-related, erg-3, p55, TMPRSS2-ERG prostate cancer specific, transcriptional regulator ERG, Transforming protein ERG, v-ets erythroblastosis virus E26 oncogene homolog (avian), v-ets erythroblastosis virus E26 oncogene like, v-ets erythroblastosis virus E26 oncogene like (avian) |
|---|
| Gene, Accession # | ERG, Gene ID: 2078, Accession: P11308, SwissProt: P11308 |
|---|
| Catalog # | NBP2-38555 |
|---|
| Price | |
|---|
| Order / More Info | ERG Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|