| Edit |   |
|---|
| Antigenic Specificity | RPL7 |
|---|
| Clone | 2E10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA, Immunocytochemistry/Immunofluorescence. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPL7 Antibody (2E10) from Novus Biologicals is a mouse monoclonal antibody to RPL7. This antibody reacts with human. The RPL7 Antibody (2E10) has been validated for the following applications: ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | RPL7 (NP_000962.2 158 a.a. - 248 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWPFKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN |
|---|
| Other Names | humL7-1,60S ribosomal protein L7, MGC117326, ribosomal protein L7 |
|---|
| Gene, Accession # | RPL7, Gene ID: 6129, Accession: NP_000962, SwissProt: NP_000962 |
|---|
| Catalog # | H00006129-M06 |
|---|
| Price | |
|---|
| Order / More Info | RPL7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|