| Edit |   |
|---|
| Antigenic Specificity | RPL36 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPL36 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPL36. This antibody reacts with human. The RPL36 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is RPL36 - N-terminal region. Peptide sequence KGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLK. |
|---|
| Other Names | DKFZp566B023,60S ribosomal protein L36, M, ribosomal protein L36 |
|---|
| Gene, Accession # | RPL36, Gene ID: 25873, Accession: NP_056229, SwissProt: NP_056229 |
|---|
| Catalog # | NBP1-98591-20ul |
|---|
| Price | |
|---|
| Order / More Info | RPL36 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|