| Edit |   |
|---|
| Antigenic Specificity | RPL5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RPL5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RPL5. This antibody reacts with mouse. The RPL5 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the C terminal of Rpl5. Immunizing peptide sequence RTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMG. |
|---|
| Other Names | DBA6,60S ribosomal protein L5, MGC117339, ribosomal protein L5 |
|---|
| Gene, Accession # | RPL5, Gene ID: 6125, Accession: P47962 |
|---|
| Catalog # | NBP1-74074 |
|---|
| Price | |
|---|
| Order / More Info | RPL5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|