| Edit |   |
|---|
| Antigenic Specificity | Lysophosphatidylcholine Acyltransferase 1 (LPCAT1) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Lysophosphatidylcholine (LPC) acyltransferase (LPCAT, EC 2.3.1.23) catalyzes the conversion of LPC to phosphatidylcholine (PC) in the remodeling pathway of PC biosynthesis. |
|---|
| Immunogen | LPCAT1 antibody was raised using the middle region of LPCAT1 corresponding to a region with amino acids LRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEF |
|---|
| Other Names | AYTL2|Aytl2|RGD1311599|PFAAP3|lpcat|si:dkey-261i16.4|zgc:158232|2900035H07Rik|BB137372|BC005662|C87117|LPCAT|rd11 |
|---|
| Gene, Accession # | Gene ID: 79888,210992,361467 |
|---|
| Catalog # | ABIN635206 |
|---|
| Price | |
|---|
| Order / More Info | Lysophosphatidylcholine Acyltransferase 1 (LPCAT1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|