| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | 14-3-3 epsilon |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The 14-3-3 epsilon Antibody from Novus Biologicals is a rabbit polyclonal antibody to 14-3-3 epsilon. This antibody reacts with human, mouse, rat. The 14-3-3 epsilon Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat 14-3-3 epsilon antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE |
|---|
| Other Names | 14-3-3 epsilon, 14-3-3 protein epsilon, FLJ45465, FLJ53559,14-3-3E, KCIP-1, MDCR, MDS, mitochondrial import stimulation factor L subunit, protein kinase C inhibitor protein-1, tyrosine 3/tryptophan 5 -monooxygenase activation protein, epsilon polypeptide, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilonpolypeptide |
|---|
| Gene, Accession # | YWHAE, Gene ID: 7531 |
|---|
| Catalog # | NBP1-89827 |
|---|
| Price | |
|---|
| Order / More Info | 14-3-3 epsilon Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22223660, 25540887 |
|---|
| 产品资料 |
|
|