| Edit |   |
|---|
| Antigenic Specificity | Epsin 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Epsin 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Epsin 1. This antibody reacts with human. The Epsin 1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Epsin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AIEESKRETGGKEESSLMDLADVFTAPAPAPTTDPWGGPAPMAAAVPTAAPTSDPWGGPPVPPAADPW |
|---|
| Other Names | EH domain-binding mitotic phosphoprotein, EPS-15-interacting protein 1, epsin 1, epsin-1 |
|---|
| Gene, Accession # | EPN1, Gene ID: 29924 |
|---|
| Catalog # | NBP2-56738 |
|---|
| Price | |
|---|
| Order / More Info | Epsin 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|