| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Orai2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Orai2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Orai2. This antibody reacts with human. The Orai2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Orai2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSW |
|---|
| Other Names | CAP-binding protein complex interacting protein 2, CAP-binding protein complex-interacting protein 2, CBCIP2C7orf19FLJ12474, chromosome 7 open reading frame 19, FLJ14733, H_NH0514P08.8, MEM142B, ORAI calcium release-activated calcium modulator 2, protein orai-2, putative protein ORAI2-2, TMEM142B, Transmembrane protein 142BFLJ44818 |
|---|
| Gene, Accession # | ORAI2, Gene ID: 80228 |
|---|
| Catalog # | NBP2-55443 |
|---|
| Price | |
|---|
| Order / More Info | Orai2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|