| 产品详情 |
| Edit |   |
| Antigenic Specificity | NF-M |
| Clone | 2688 |
| Host Species | Mouse |
| Reactive Species | human, mouse, rat |
| Isotype | IgG1 |
| Format | Protein A purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. It has been reported that the antibody gives weak staining when testing in IHC on frozen tissue sections. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NF-M Antibody (2688) from Novus Biologicals is a mouse monoclonal antibody to NF-M. This antibody reacts with human, mouse, rat. The NF-M Antibody (2688) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat NF-M antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH |
| Other Names | NEF3neurofilament medium polypeptide, Neurofilament 3, neurofilament, medium polypeptide, neurofilament, medium polypeptide 150kDa, neurofilament-3 (150 kD medium), NF-M160 kDa neurofilament protein, NFMNeurofilament triplet M protein |
| Gene, Accession # | NEFM, Gene ID: 4741, Accession: P07197 |
| Catalog # | NBP2-46618 |
| Price | |
| Order / More Info | NF-M Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|