| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CBR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CBR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CBR1. This antibody reacts with human. The CBR1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunofluorescence. |
|---|
| Immunogen | Synthetic peptides corresponding to CBR1(carbonyl reductase 1) The peptide sequence was selected form the middle region of CBR1. Peptide sequence AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ. |
|---|
| Other Names | 15-hydroxyprostaglandin dehydrogenase [NADP+], carbonyl reductase (NADPH) 1, carbonyl reductase (NADPH) 1, EC 1.1.1.18410EC 1.1.1.197,15-hydroxyprostaglandin dehydrogenase, carbonyl reductase [NADPH] 1, carbonyl reductase 1, CBR, CRN, EC 1.1.1.184, EC 1.1.1.189, hCBR1, NADPH-dependent carbonyl reductase 1, Prostaglandin 9-ketoreductase, Prostaglandin-E(2) 9-reductase, SDR21C1, short chain dehydrogenase/reductase family 21C, member 1 |
|---|
| Gene, Accession # | CBR1, Gene ID: 873, Accession: P16152, SwissProt: P16152 |
|---|
| Catalog # | NBP1-52871 |
|---|
| Price | |
|---|
| Order / More Info | CBR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|