| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Derlin 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence fixation permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Derlin 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Derlin 1. This antibody reacts with human. The Derlin 1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Derlin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ |
|---|
| Other Names | DER-1, DER1Degradation in endoplasmic reticulum protein 1, Der1-like domain family, member 1, Der1-like protein 1, derlin-1, DERtrin-1, FLJ13784, FLJ42092, MGC3067, PRO2577 |
|---|
| Gene, Accession # | DERL1, Gene ID: 79139 |
|---|
| Catalog # | NBP1-88023 |
|---|
| Price | |
|---|
| Order / More Info | Derlin 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|