| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MFF (exon 1) |
|---|
| Clone | N382/69 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG1 |
|---|
| Format | supernatant |
|---|
| Size | 5 mL |
|---|
| Concentration | lot dependent |
|---|
| Applications | ICC, IHC, WB. Specificity KO validated |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | n/a |
|---|
| Immunogen | Fusion protein amino acids 1-173 (MSKRTSSDTPLGRVSGAAFPSPTASEMAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPVTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRNDSV, cytoplasmic N-terminal exons 1, 2, 3 and 4) and 272-322 (YGISNIEATIEGTSDDMTVVDAASLRRQIIKLNRRLQLLEEENKERAKREM, cytoplasmic N-terminal exons 8 and mostof 9) of mostly human MFF (also known as Mitochondrial fission factor, C2orf33, AD030,AD033 and GL004, accession number Q9GZY8)Human: 96% identity (167/173 amino acids identical) and 94% identity (48/51 amino acids identical)Rat: 95% identity (141/147 amino acids identical) and 92% identity (47/51 amino acids identical)Mouse: 93% identity (138/147 amino acids identical) and 84% identity (43/51 amino acids identical) |
|---|
| Other Names | Mitochondrial fission factor |
|---|
| Gene, Accession # | MFF C2orf33 AD030 AD033 GL004 |
|---|
| Catalog # | 73-373 |
|---|
| Price | |
|---|
| Order / More Info | MFF (exon 1) Antibody from NEUROMAB |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|