| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cylicin 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cylicin 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cylicin 1. This antibody reacts with human. The Cylicin 1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Cylicin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KKDSKKDDKKKDAKKNAESTEMESDLELKKDKKHSKEKKGSKKDIKKDARKDTESTDAEFDESSKTGFKTSTKIKGSDTESEESLYKP |
|---|
| Other Names | CYCL1, CYL, CYL1, cylicin 1, cylicin I, cylicin, basic protein of sperm head cytoskeleton 1, cylicin-1, multiple-band polypeptide I |
|---|
| Gene, Accession # | CYLC1, Gene ID: 1538 |
|---|
| Catalog # | NBP2-56428 |
|---|
| Price | |
|---|
| Order / More Info | Cylicin 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|