| Edit |   |
|---|
| Antigenic Specificity | PPP1R15B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPP1R15B Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP1R15B. This antibody reacts with human. The PPP1R15B Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the C terminal of PPP1R15B. Immunizing peptide sequence SFCSVDPYNPQNFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSL. |
|---|
| Other Names | CREP, FLJ14744, protein phosphatase 1 regulatory subunit 15B, protein phosphatase 1, regulatory (inhibitor) subunit 15B |
|---|
| Gene, Accession # | PPP1R15B, Gene ID: 84919, Accession: Q5SWA1, SwissProt: Q5SWA1 |
|---|
| Catalog # | NBP1-74269-20ul |
|---|
| Price | |
|---|
| Order / More Info | PPP1R15B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|