| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPP1R12C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPP1R12C Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP1R12C. This antibody reacts with human. The PPP1R12C Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PPP1R12C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DIARYLLSHGANIAAVNSDGDLPLDLAESDAMEGLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHV |
|---|
| Other Names | DKFZp434D0412, LENG3, leukocyte receptor cluster (LRC) encoded novel gene 3, leukocyte receptor cluster (LRC) member 3, MBS85, myosin-binding subunit 85, p84, p85, protein phosphatase 1 myosin-binding subunit of 85 kDa, protein phosphatase 1 myosin-binding subunit p85, protein phosphatase 1 regulatory subunit 12C, protein phosphatase 1, regulatory (inhibitor) subunit 12C, protein phosphatase 1, regulatory subunit 12C |
|---|
| Gene, Accession # | PPP1R12C, Gene ID: 54776 |
|---|
| Catalog # | NBP1-94079 |
|---|
| Price | |
|---|
| Order / More Info | PPP1R12C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|