| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPP2R2D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPP2R2D Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP2R2D. This antibody reacts with human. The PPP2R2D Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PPP2R2D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FEEPEDPSSRSFFSEIISSISDVKFSHSGRYM |
|---|
| Other Names | KIAA1541, MDS026, PP2A subunit B isoform B55-delta, PP2A subunit B isoform delta, PP2A subunit B isoform PR55-delta, PP2A subunit B isoform R2-delta, protein phosphatase 2, regulatory subunit B, delta, protein phosphatase 2, regulatory subunit B, delta isoform, serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B deltaisoform |
|---|
| Gene, Accession # | PPP2R2D, Gene ID: 55844, Accession: Q66LE6, SwissProt: Q66LE6 |
|---|
| Catalog # | NBP2-33379 |
|---|
| Price | |
|---|
| Order / More Info | PPP2R2D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|