| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPP2R5D |
|---|
| Clone | 1A3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPP2R5D Antibody (1A3) from Novus Biologicals is a mouse monoclonal antibody to PPP2R5D. This antibody reacts with human. The PPP2R5D Antibody (1A3) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | PPP2R5D (NP_006236.1 514 a.a. - 602 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL |
|---|
| Other Names | MGC2134, MGC8949, PP2A B subunit isoform B56-delta, PP2A B subunit isoform B'-delta, PP2A B subunit isoform PR61-delta, PP2A B subunit isoform R5-delta, PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, protein phosphatase 2, regulatory subunit B', delta, regulatory subunit B (B56), delta isoform, regulatory subunit B', delta isoform, Serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, deltaisoform, serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform |
|---|
| Gene, Accession # | PPP2R5D, Gene ID: 5528, Accession: NP_006236, SwissProt: NP_006236 |
|---|
| Catalog # | H00005528-M21 |
|---|
| Price | |
|---|
| Order / More Info | PPP2R5D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|