| Edit |   |
| Antigenic Specificity | Lysophospholipase II (LYPLA2) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet. |
| Immunogen | LYPLA2 antibody was raised using the N terminal of LYPLA2 corresponding to a region with amino acids MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP |
| Other Names | MGC52664|MGC75683|lypla2|LysoII|LYPLA2P1|APT-2|DJ886K2.4 |
| Gene, Accession # | Gene ID: 11313,26394,83510 |
| Catalog # | ABIN632189 |
| Price | |
| Order / More Info | Lysophospholipase II (LYPLA2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |