| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RBM8A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RBM8A Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBM8A. This antibody reacts with human. The RBM8A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human RBM8A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFV |
|---|
| Other Names | Binder of OVCA1-1, BOV-1, BOV-1A, BOV-1B, BOV-1C, MDS014, RBM8BRBM8, ribonucleoprotein RBM8, Ribonucleoprotein RBM8A, RNA binding motif protein 8A, RNA binding motif protein 8B, RNA-binding motif protein 8A, RNA-binding protein 8A, RNA-binding protein Y14, Y14, ZNRP, ZRNP1 |
|---|
| Gene, Accession # | RBM8A, Gene ID: 9939 |
|---|
| Catalog # | NBP1-88376 |
|---|
| Price | |
|---|
| Order / More Info | RBM8A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23917022 |
|---|
| 产品资料 |
|
|