| Edit |   |
|---|
| Antigenic Specificity | Epidermal Growth Factor (EGF) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. |
|---|
| Immunogen | EGF antibody was raised using a synthetic peptide corresponding to a region with amino acids ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY |
|---|
| Other Names | HOMG4|URG|AI790464|CEGF |
|---|
| Gene, Accession # | Gene ID: 1950 |
|---|
| Catalog # | ABIN634270 |
|---|
| Price | |
|---|
| Order / More Info | Epidermal Growth Factor (EGF) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|