| Edit |   |
|---|
| Antigenic Specificity | Claudin Domain Containing 1 (CLDND1) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CLDND1 belongs to the PMP-22/EMP/MP20 family. The exact function of CLDND1 remains unknown. |
|---|
| Immunogen | Claudin Domain Containing 1 antibody was raised using the middle region of CLDND1 corresponding to a region with amino acids TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL |
|---|
| Other Names | MGC53751|LOC100217896|1110019C08Rik|AA407103|AI849195|AW489850|Cldnd1|C3orf4|GENX-3745 |
|---|
| Gene, Accession # | Gene ID: 56650,224250,288182 |
|---|
| Catalog # | ABIN634913 |
|---|
| Price | |
|---|
| Order / More Info | Claudin Domain Containing 1 (CLDND1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|