| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MRPL53 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MRPL53 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MRPL53. This antibody reacts with human. The MRPL53 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MRPL53 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTALE |
|---|
| Other Names | FLJ90728, L53mt, MGC20402,39S ribosomal protein L53, mitochondrial, mitochondrial ribosomal protein L53, MRP-L53 |
|---|
| Gene, Accession # | MRPL53, Gene ID: 116540, Accession: Q96EL3, SwissProt: Q96EL3 |
|---|
| Catalog # | NBP2-31629 |
|---|
| Price | |
|---|
| Order / More Info | MRPL53 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|