| Edit |   |
|---|
| Antigenic Specificity | rho Guanine Nucleotide Exchange Factor (GEF) 19 (ARHGEF19) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Guanine nucleotide exchange factors (GEFs) such as ARHGEF19 accelerate the GTPase activity of Rho GTPases. |
|---|
| Immunogen | ARHGEF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS |
|---|
| Other Names | WGEF|6030432F23|6430573B13Rik |
|---|
| Gene, Accession # | Gene ID: 128272 |
|---|
| Catalog # | ABIN633111 |
|---|
| Price | |
|---|
| Order / More Info | rho Guanine Nucleotide Exchange Factor (GEF) 19 (ARHGEF19) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|