| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | APPL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The APPL Antibody from Novus Biologicals is a rabbit polyclonal antibody to APPL. This antibody reacts with human. The APPL Antibody has been validated for the following applications: Western Blot. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNR |
|---|
| Other Names | Adapter protein containing PH domain, PTB domain and leucine zipper motif 1, adaptor protein containing pH domain, PTB domain and leucine zipper motif 1, adaptor protein, phosphotyrosine interaction, PH domain and leucine zippercontaining 1, AKT2 interactor, APPLdip13-alpha, DCC-interacting protein 13-alpha, DIP 13 alpha, DIP13A, Dip13-alpha, DIP13alpha, KIAA1428, signaling adaptor protein DIP13alpha |
|---|
| Gene, Accession # | APPL1, Gene ID: 26060 |
|---|
| Catalog # | NBP2-76565 |
|---|
| Price | |
|---|
| Order / More Info | APPL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|