| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Nogo B receptor |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Nogo B receptor Antibody from Novus Biologicals is a rabbit polyclonal antibody to Nogo B receptor. This antibody reacts with human. The Nogo B receptor Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Nogo B receptor antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK |
|---|
| Other Names | C6orf68MGC117249, chromosome 6 open reading frame 68, MGC:7199, MGC7199, NgBR, nogo-B receptor, Nuclear undecaprenyl pyrophosphate synthase 1 homolog, nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae) |
|---|
| Gene, Accession # | NUS1, Gene ID: 116150 |
|---|
| Catalog # | NBP1-88252 |
|---|
| Price | |
|---|
| Order / More Info | Nogo B receptor Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|