| Edit |   |
|---|
| Antigenic Specificity | NBPF3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 41%, rat 43%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human NBPF3 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RELLDEKEPEVLQDSLDRCYSTPSGYLELP |
|---|
| Other Names | neuroblastoma breakpoint family member 3, AE2 |
|---|
| Gene, Accession # | Gene ID: 84224, UniProt: Q9H094, ENSG00000142794 |
|---|
| Catalog # | HPA046971 |
|---|
| Price | |
|---|
| Order / More Info | NBPF3 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|